PDB entry 1igd

View 1igd on RCSB PDB site
Description: the third igg-binding domain from streptococcal protein g: an analysis by x-ray crystallography of the structure alone and in a complex with fab
Class: immunoglobulin binding protein
Keywords: immunoglobulin binding protein
Deposited on 1994-08-05, released 1994-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.193
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g
    Species: Streptococcus sp. G148 [TaxId:1324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1igda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igdA (A:)
    mtpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt
    e