PDB entry 1igc

View 1igc on RCSB PDB site
Description: igg1 fab fragment (mopc21) complex with domain III of protein g from streptococcus
Class: complex (antibody/binding protein)
Keywords: protein g, streptococcus, complex (antibody/binding protein) complex
Deposited on 1994-08-05, released 1995-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.168
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptococcal protein g (domain III)
    Species: Streptococcus sp. G148 [TaxId:1324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1igca_
  • Chain 'H':
    Compound: igg1-kappa mopc21 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01783 (3-219)
      • conflict (4)
      • conflict (12)
      • conflict (17)
      • conflict (30-31)
      • conflict (57-58)
      • conflict (74)
      • conflict (91)
      • conflict (99-102)
      • conflict (105)
      • conflict (193-194)
      • conflict (197)
    Domains in SCOPe 2.05: d1igch1, d1igch2
  • Chain 'L':
    Compound: igg1-kappa mopc21 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01634 (0-212)
      • conflict (91)
    Domains in SCOPe 2.05: d1igcl1, d1igcl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1igcA (A:)
    mtpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igcA (A:)
    avttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igcH (H:)
    dvqlvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstlhy
    adtvkgrftisrdnpkntlflqmtslrsedtgmyycarwgnypyyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igcL (L:)
    nivmtqspksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqgnsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec