PDB entry 1igc

View 1igc on RCSB PDB site
Description: igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus
Deposited on 1994-08-05, released 1995-06-03
The last revision prior to the SCOP 1.69 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.168
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1igcA (A:)
    mtpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igcA (A:)
    avttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igcH (H:)
    dvqlvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstlhy
    adtvkgrftisrdnpkntlflqmtslrsedtgmyycarwgnypyyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igcL (L:)
    nivmtqspksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqgnsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec