PDB entry 1ig7

View 1ig7 on RCSB PDB site
Description: Msx-1 Homeodomain/DNA Complex Structure
Class: transcription/DNA
Keywords: helix-turn-helix, TRANSCRIPTION/DNA COMPLEX
Deposited on 2001-04-17, released 2001-04-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeotic protein Msx-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ig7a_
  • Chain 'B':
    Compound: 5'-d(*cp*ap*cp*tp*ap*ap*tp*tp*gp*ap*ap*gp*g)-3'
  • Chain 'C':
    Compound: 5'-d(p*tp*cp*cp*tp*tp*cp*ap*ap*tp*tp*ap*gp*tp*gp*ap*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ig7A (A:)
    rkprtpfttaqllalerkfrqkqylsiaeraefssslsltetqvkiwfqnrrakakrl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.