PDB entry 1ig5

View 1ig5 on RCSB PDB site
Description: bovine calbindin d9k binding mg2+
Class: metal binding protein
Keywords: calcium-binding protein, ef-hand, magnesium binding, metal binding protein
Deposited on 2001-04-17, released 2001-04-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vitamin d-dependent calcium-binding protein, intestinal
    Species: Bos taurus [TaxId:9913]
    Gene: synthetic gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ig5a_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ig5A (A:)
kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdge
vsfeefqvlvkkisq