PDB entry 1ig5

View 1ig5 on RCSB PDB site
Description: bovine calbindin d9k binding mg2+
Deposited on 2001-04-17, released 2001-04-25
The last revision prior to the SCOP 1.61 freeze date was dated 2001-04-25, with a file datestamp of 2001-04-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1ig5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ig5A (A:)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdge
  vsfeefqvlvkkisq