PDB entry 1ig4

View 1ig4 on RCSB PDB site
Description: Solution Structure of the Methyl-CpG-Binding Domain of Human MBD1 in Complex with Methylated DNA
Class: transcription/DNA
Keywords: protein-DNA complex, alpha-beta, double helix, recognition via beta-sheet, transcription/DNA complex
Deposited on 2001-04-17, released 2001-05-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Methyl-CpG Binding Protein
  Species: Homo sapiens [TaxId:9606]
  Gene: MBD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UIS9 (0-74)
  Domains in SCOPe 2.02: d1ig4a_
• Chain 'B':
  Compound: 5'-d(*gp*tp*ap*tp*cp*(5cm)p*gp*gp*ap*tp*ap*c)-3'
  
• Chain 'C':
  Compound: 5'-d(*gp*tp*ap*tp*cp*(5cm)p*gp*gp*ap*tp*ap*c)-3'
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ig4A (A:)
  maedwldcpalgpgwkrrevfrksgatcgrsdtyyqsptgdrirskveltrylgpacdlt
  lfdfkqgilcypapk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.