PDB entry 1ig4

View 1ig4 on RCSB PDB site
Description: solution structure of the methyl-cpg-binding domain of human mbd1 in complex with methylated dna
Deposited on 2001-04-17, released 2001-05-30
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-30, with a file datestamp of 2001-05-30.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1ig4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ig4A (A:)
  maedwldcpalgpgwkrrevfrksgatcgrsdtyyqsptgdrirskveltrylgpacdlt
  lfdfkqgilcypapk