PDB entry 1ig0

View 1ig0 on RCSB PDB site
Description: Crystal Structure of yeast Thiamin Pyrophosphokinase
Class: transferase
Keywords: Protein-substrate complex, compound active site, alpha-beta-alpha, beta sandwich, TRANSFERASE
Deposited on 2001-04-16, released 2001-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.217
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiamin pyrophosphokinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: THI80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ig0a1, d1ig0a2
  • Chain 'B':
    Compound: thiamin pyrophosphokinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: THI80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ig0b1, d1ig0b2
  • Heterogens: VIB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ig0A (A:)
    mseecienperikigtdlinirnkmnlkelihpnedenstllilnqkidiprplfykiwk
    lhdlkvcadgaanrlydyldddetlrikylpnyiigdldslsekvykyyrknkvtiikqt
    tqystdftkcvnlislhfnspefrslisnkdnlqsnhgielekgihtlyntmteslvfsk
    vtpisllalggiggrfdqtvhsitqlytlsenasyfklcymtptdliflikkngtlieyd
    pqfrntcigncgllpigeatlvketrglkwdvknwptsvvtgrvsssnrfvgdnccfidt
    kddiilnveifvdklidfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ig0A (A:)
    eecienperikigtdlinirnkmnlkelihpnedenstllilnqkidiprplfykiwklh
    dlkvcadgaanrlydyldddetlrikylpnyiigdldslsekvykyyrknkvtiikqttq
    ystdftkcvnlislhfnspefrslisnkdnlqsnhgielekgihtlyntmteslvfskvt
    pisllalggiggrfdqtvhsitqlytlsenasyfklcymtptdliflikkngtlieydpq
    frntcigncgllpigeatlvketrglkwdvknwptsvvtgrvsssnrfvgdnccfidtkd
    diilnveifvdklidfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ig0B (B:)
    mseecienperikigtdlinirnkmnlkelihpnedenstllilnqkidiprplfykiwk
    lhdlkvcadgaanrlydyldddetlrikylpnyiigdldslsekvykyyrknkvtiikqt
    tqystdftkcvnlislhfnspefrslisnkdnlqsnhgielekgihtlyntmteslvfsk
    vtpisllalggiggrfdqtvhsitqlytlsenasyfklcymtptdliflikkngtlieyd
    pqfrntcigncgllpigeatlvketrglkwdvknwptsvvtgrvsssnrfvgdnccfidt
    kddiilnveifvdklidfl