PDB entry 1ifw

View 1ifw on RCSB PDB site
Description: solution structure of c-terminal domain of poly(a) binding protein from saccharomyces cerevisiae
Class: RNA binding protein
Keywords: all-helical domain, RNA BINDING PROTEIN
Deposited on 2001-04-13, released 2002-07-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyadenylate-binding protein, cytoplasmic and nuclear
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PAB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04147 (5-91)
      • cloning artifact (0-4)
    Domains in SCOPe 2.01: d1ifwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ifwA (A:)
    gplgsprnandnnqfyqqkqrqalgeqlykkvsaktsneeaagkitgmildlppqevfpl
    lesdelfeqhykeasaayesfkkeqeqqteqa