PDB entry 1ifq

View 1ifq on RCSB PDB site
Description: Sec22b N-terminal domain
Class: protein transport
Keywords: five-stranded anti-parallel beta sheet, alpha/beta 3-layer sandwich, protein transport
Deposited on 2001-04-13, released 2001-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.231
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vesicle trafficking protein Sec22b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08547 (12-137)
      • expression tag (11)
      • modified residue (16)
      • modified residue (30)
      • modified residue (69)
      • modified residue (69)
    Domains in SCOPe 2.06: d1ifqa1, d1ifqa2
  • Chain 'B':
    Compound: vesicle trafficking protein Sec22b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08547 (12-137)
      • expression tag (10-11)
      • modified residue (16)
      • modified residue (30)
      • modified residue (69)
      • modified residue (69)
    Domains in SCOPe 2.06: d1ifqb1, d1ifqb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ifqA (A:)
    mrgshhhhhhgsvlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsp
    trctleagamtfhyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrp
    ysfiefdtfiqktkklyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ifqA (A:)
    svlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsptrctleagamt
    fhyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrpysfiefdtfiq
    ktkklyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ifqB (B:)
    mrgshhhhhhgsvlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsp
    trctleagamtfhyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrp
    ysfiefdtfiqktkklyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ifqB (B:)
    gsvlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsptrctleagam
    tfhyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrpysfiefdtfi
    qktkklyi