PDB entry 1ifq

View 1ifq on RCSB PDB site
Description: Sec22b N-terminal domain
Deposited on 2001-04-13, released 2001-05-02
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.231
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ifqa_
  • Chain 'B':
    Domains in SCOP 1.57: d1ifqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ifqA (A:)
    svlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsptrctleagamt
    fhyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrpysfiefdtfiq
    ktkklyi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ifqB (B:)
    gsvlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsptrctleagam
    tfhyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrpysfiefdtfi
    qktkklyi