PDB entry 1ifn

View 1ifn on RCSB PDB site
Description: two forms of pf1 inovirus: x-ray diffraction studies on a structural phase transition and a calculated libration normal mode of the asymmetric unit
Class: Virus
Keywords: VIRUS, Helical virus
Deposited on 1994-01-31, released 1994-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: FIBER
Resolution: 4 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inovirus
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ifna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ifnA (A:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka