PDB entry 1ifj

View 1ifj on RCSB PDB site
Description: molecular models and structural comparisons of native and mutant class I filamentous bacteriophages ff (fd, f1, m13), if1 and ike
Class: Virus
Keywords: VIRUS, Helical virus
Deposited on 1994-01-31, released 1994-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: FIBER
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inovirus
    Species: Enterobacteria phage fd [TaxId:10864]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ifja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ifjA (A:)
    aegddpakaafdslqasateyigyawamvvvivgatigiklfkkftskas