PDB entry 1if2

View 1if2 on RCSB PDB site
Description: x-ray structure of leishmania mexicana triosephosphate isomerase complexed with ipp
Class: isomerase
Keywords: TIM barrel, transition state analogue, isomerase
Deposited on 2001-04-12, released 2001-08-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.136
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48499 (Start-250)
      • engineered (65)
    Domains in SCOPe 2.01: d1if2a_
  • Heterogens: 129, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1if2A (A:)
    msakpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpk
    yvisaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackq
    gfmviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvat
    peqaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslk
    pefrdiidatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1if2A (A:)
    akpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpkyv
    isaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackqgf
    mviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvatpe
    qaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslkpe
    frdiidatr