PDB entry 1if2

View 1if2 on RCSB PDB site
Description: x-ray structure of leishmania mexicana triosephosphate isomerase complexed with ipp
Deposited on 2001-04-12, released 2001-08-17
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-17, with a file datestamp of 2001-08-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.136
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1if2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1if2A (A:)
    akpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpkyv
    isaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackqgf
    mviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvatpe
    qaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslkpe
    frdiidatr