PDB entry 1if1

View 1if1 on RCSB PDB site
Description: interferon regulatory factor 1 (irf-1) complex with dna
Deposited on 1997-09-12, released 1998-02-25
The last revision prior to the SCOP 1.55 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.242
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1if1a_
  • Chain 'B':
    Domains in SCOP 1.55: d1if1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1if1A (A:)
    rmrpwlemqinsnqipgliwinkeemifqipwkhaakhgwdinkdaclfrswaihtgryk
    agekepdpktwkanfrcamnslpdieevkdqsrnkgssavrvyrm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1if1B (B:)
    mrpwlemqinsnqipgliwinkeemifqipwkhaakhgwdinkdaclfrswaihtgryka
    gekepdpktwkanfrcamnslpdieevkdqsrnkgssavrvyrm