PDB entry 1iez

View 1iez on RCSB PDB site
Description: Solution Structure of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase of Riboflavin Biosynthesis
Class: isomerase
Keywords: dihydroxybutanone phosphate synthase, riboflavin biosynthesis, skeletal rearrangement, antimicrobial target, structure based design
Deposited on 2001-04-11, released 2001-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ieza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iezA (A:)
mnqtllssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltir
hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvra
aiadgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
tmarapeciefankhnmalvtiedlvayrqaherkas