PDB entry 1iez

View 1iez on RCSB PDB site
Description: Solution Structure of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase of Riboflavin Biosynthesis
Deposited on 2001-04-11, released 2001-11-07
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-07, with a file datestamp of 2001-11-07.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ieza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iezA (A:)
    mnqtllssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltir
    hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvra
    aiadgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
    tmarapeciefankhnmalvtiedlvayrqaherkas