PDB entry 1iew

View 1iew on RCSB PDB site
Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 2-deoxy-2-fluoro-alpha-d-glucoside
Deposited on 2001-04-11, released 2001-11-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-14, with a file datestamp of 2001-11-14.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.189
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iewA (A:)
    dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
    prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
    pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
    qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
    amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
    sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
    npyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilvagsha
    dnlgyqcggwtiewqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksggfsya
    ivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaasdal
    vaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyglttn
    at