PDB entry 1iet

View 1iet on RCSB PDB site
Description: apocytochrome b5, ph 6.2, 298 k, nmr, minimized average structure
Class: electron transport
Keywords: electron transport
Deposited on 1996-04-20, released 1997-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apocytochrome b5
    Species: Rattus norvegicus [TaxId:10116]
    Gene: cytb5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ieta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ietA (A:)
aeqsdkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdate
nfedvghstdarelsktyiigelhpddrskiakpsetl

    Sequence, based on observed residues (ATOM records): (download) 
    >1ietA (A:)
dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktyiigelhpddrskiakpsetl