PDB entry 1iep

View 1iep on RCSB PDB site
Description: crystal structure of the c-abl kinase domain in complex with sti-571.
Class: transferase
Keywords: kinase, kinase inhibitor, sti-571, activation loop
Deposited on 2001-04-10, released 2001-04-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.231
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proto-oncogene tyrosine-protein kinase abl
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (6-End)
      • cloning artifact (2-5)
    Domains in SCOP 1.73: d1iepa_
  • Chain 'B':
    Compound: proto-oncogene tyrosine-protein kinase abl
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (6-End)
      • cloning artifact (2-5)
    Domains in SCOP 1.73: d1iepb_
  • Heterogens: CL, STI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iepA (A:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iepA (A:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
    keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
    tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
    wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
    pekvyelmracwqwnpsdrpsfaeihqafetmfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iepB (B:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iepB (B:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
    keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
    tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
    wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
    pekvyelmracwqwnpsdrpsfaeihqafetmfq