PDB entry 1iej

View 1iej on RCSB PDB site
Description: ovotransferrin, n-terminal lobe, holo form, at 1.65 a resolution
Class: metal binding protein
Keywords: transferrin, iron, ovotransferrin, METAL BINDING PROTEIN
Deposited on 2001-04-10, released 2001-06-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovotransferrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02789 (Start-331)
      • conflict (57)
      • conflict (63)
    Domains in SCOPe 2.04: d1ieja_
  • Heterogens: FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iejA (A:)
    appksvirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaitld
    ggqvfeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglg
    rsagwnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpkt
    kcarnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyk
    tcnwarvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllf
    kdsaimlkrvpslmdsqlylgfeyysaiqsmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iejA (A:)
    ksvirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaitldggq
    vfeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglgrsa
    gwnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpktkca
    rnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyktcn
    warvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllfkds
    aimlkrvpslmdsqlylgfeyysaiqsmr