PDB entry 1ieh

View 1ieh on RCSB PDB site
Description: solution structure of a soluble single-domain antibody with hydrophobic residues typical of a vl/vh interface
Class: immune system
Keywords: two pleated beta-sheet, immunoglobulin beta-barrel, IMMUNE SYSTEM
Deposited on 2001-04-09, released 2002-08-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bruc.d4.4
  Species: LAMA GLAMA [TaxId:9844]
  Database cross-references and differences (RAF-indexed):
  • PDB 1IEH (0-134)
  Domains in SCOPe 2.04: d1ieha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iehA (A:)
  dvqlqasggglvqpggslrvscaasgftfssyhmawvrqapgkglewvstinpgdgstyy
  adsvkgrftisrdnakntlylqmnslksedtavyycakysggaldawgqgtqvtvssqse
  qkliseedlnhhhhh