PDB entry 1ieh

View 1ieh on RCSB PDB site
Description: solution structure of a soluble single-domain antibody with hydrophobic residues typical of a vl/vh interface
Deposited on 2001-04-09, released 2002-08-07
The last revision prior to the SCOP 1.63 freeze date was dated 2002-08-07, with a file datestamp of 2002-08-07.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1ieha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iehA (A:)
  dvqlqasggglvqpggslrvscaasgftfssyhmawvrqapgkglewvstinpgdgstyy
  adsvkgrftisrdnakntlylqmnslksedtavyycakysggaldawgqgtqvtvssqse
  qkliseedlnhhhhh