PDB entry 1ieb

View 1ieb on RCSB PDB site
Description: histocompatibility antigen
Class: histocompatibility antigen
Keywords: histocompatibility antigen
Deposited on 1996-04-05, released 1997-06-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II I-ek
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ieba1, d1ieba2
  • Chain 'B':
    Compound: MHC class II I-ek
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1iebb1, d1iebb2
  • Chain 'C':
    Compound: MHC class II I-ek
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1iebc1, d1iebc2
  • Chain 'D':
    Compound: MHC class II I-ek
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1iebd1, d1iebd2
  • Heterogens: NAG, NDG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iebA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iebA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iebB (B:)
    rdsrdrmvnhfiaefkrkggslvprgsggggsrpwfleycksechfyngtqrvrllvryf
    ynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflv
    prrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrng
    dwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iebB (B:)
    rdrmvnhfiaefkrkggslvprgsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iebC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iebC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iebD (D:)
    rdsrdrmvnhfiaefkrkggslvprgsggggsrpwfleycksechfyngtqrvrllvryf
    ynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflv
    prrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrng
    dwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iebD (D:)
    rdrmvnhfiaefkrkggslvprgsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvew