PDB entry 1ieb

View 1ieb on RCSB PDB site
Description:
Deposited on 1996-04-05, released 1997-06-05
The last revision prior to the SCOP 1.63 freeze date was dated 1997-06-05, with a file datestamp of 1997-06-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ieba1, d1ieba2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1iebb1, d1iebb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1iebc1, d1iebc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1iebd1, d1iebd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iebA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iebB (B:)
    rdrmvnhfiaefkrkggslvprgsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iebC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iebD (D:)
    rdrmvnhfiaefkrkggslvprgsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvew