PDB entry 1iea

View 1iea on RCSB PDB site
Description: histocompatibility antigen
Class: histocompatibility antigen
Keywords: histocompatibility antigen
Deposited on 1996-04-05, released 1997-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II I-ek
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ieaa1, d1ieaa2
  • Chain 'B':
    Compound: MHC class II I-ek
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ieab1, d1ieab2
  • Chain 'C':
    Compound: MHC class II I-ek
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ieac1, d1ieac2
  • Chain 'D':
    Compound: MHC class II I-ek
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iead1, d1iead2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ieaA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ieaA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ieaB (B:)
    rdsrgkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvry
    fynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnfl
    vprrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrn
    gdwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ieaB (B:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ieaC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ieaC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ieaD (D:)
    rdsrgkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvry
    fynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnfl
    vprrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrn
    gdwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ieaD (D:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvew