PDB entry 1ie7

View 1ie7 on RCSB PDB site
Description: phosphate inhibited bacillus pasteurii urease crystal structure
Class: hydrolase
Keywords: urease, bacillus pasteurii, nickel, metalloenzyme, hydrolase
Deposited on 2001-04-09, released 2001-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease gamma subunit
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41022 (0-99)
      • modified residue (0)
    Domains in SCOPe 2.07: d1ie7a_
  • Chain 'B':
    Compound: urease beta subunit
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ie7b_
  • Chain 'C':
    Compound: urease alpha subunit
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41020 (0-569)
      • conflict (18)
      • insertion (27)
      • conflict (28)
      • conflict (35-37)
      • modified residue (219)
      • conflict (262)
      • conflict (326)
      • conflict (419)
    Domains in SCOPe 2.07: d1ie7c1, d1ie7c2
  • Heterogens: NI, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ie7A (A:)
    mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ie7B (B:)
    msnnnyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdra
    egigrrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakel
    gykgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ie7B (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ie7C (C:)
    mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
    trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
    viaaegkivtaggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwni
    ekmlksteglpinvgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvad
    eadvqvaihsdtlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpss
    tnptrpftvntidehldmlmvchhlknnipedvafadsrirpetiaaedilhdlgiismm
    stdalamgragemvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgi
    ahevgsieegkfadlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmy
    gtvgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidin
    petyevkvdgevltcepvkelpmaqryflf