PDB entry 1ie4

View 1ie4 on RCSB PDB site
Description: rat transthyretin complex with thyroxine (t4)
Class: transport protein
Keywords: transport protein, transport of thyroid hormones, rat transthyretin, prealbumin, thyroxine complex
Deposited on 2001-04-06, released 2002-04-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ie4a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ie4b_
  • Chain 'C':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ie4c_
  • Chain 'D':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ie4d_
  • Heterogens: T44, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ie4A (A:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ie4A (A:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ie4B (B:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ie4B (B:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ie4C (C:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ie4C (C:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ie4D (D:)
    gpggageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhgltt
    dekftegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysystta
    vvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ie4D (D:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn