PDB entry 1ie3

View 1ie3 on RCSB PDB site
Description: crystal structure of r153c e. coli malate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, dehydrogenase, malate dehydrogenase, substrate specificity
Deposited on 2001-04-05, released 2001-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.186
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: MDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61889 (0-311)
      • engineered (152)
      • see remark 999 (306)
    Domains in SCOPe 2.07: d1ie3a1, d1ie3a2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: MDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61889 (0-311)
      • engineered (152)
      • see remark 999 (306)
    Domains in SCOPe 2.07: d1ie3b1, d1ie3b2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: MDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61889 (0-311)
      • engineered (152)
      • see remark 999 (306)
    Domains in SCOPe 2.07: d1ie3c1, d1ie3c2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: MDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61889 (0-311)
      • engineered (152)
      • see remark 999 (306)
    Domains in SCOPe 2.07: d1ie3d1, d1ie3d2
  • Heterogens: NAD, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ie3A (A:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ie3B (B:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ie3C (C:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ie3D (D:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk