PDB entry 1ie0

View 1ie0 on RCSB PDB site
Description: crystal structure of luxs
Class: structural genomics
Keywords: four stranded antiparallel beta sheet, cysteine-sulfonic acid, structural genomics
Deposited on 2001-04-05, released 2001-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.174
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autoinducer-2 production protein luxs
    Species: Bacillus subtilis [TaxId:1423]
    Gene: luxS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34667 (Start-156)
      • modified residue (83)
    Domains in SCOPe 2.06: d1ie0a_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ie0A (A:)
mpsvesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehll
aftirshaekydhfdiidispmgcqtgyylvvsgeptsaeivdlledtmkeaveiteipa
anekqcgqaklhdlegakrlmrfwlsqdkeellkvfg

    Sequence, based on observed residues (ATOM records): (download) 
    >1ie0A (A:)
psvesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehlla
ftirshaekydhfdiidispmgcqtgyylvvsgeptsaeivdlledtmkeaveiteipaa
nekqcgqaklhdlegakrlmrfwlsqdkeellkvfg