PDB entry 1idy

View 1idy on RCSB PDB site
Description: structure of myb transforming protein, nmr, minimized average structure
Class: DNA-binding protein
Keywords: protooncogene product, DNA-binding protein
Deposited on 1996-08-15, released 1996-12-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mouse c-myb DNA-binding domain repeat 3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06876 (1-53)
      • engineered (15)
    Domains in SCOPe 2.03: d1idya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idyA (A:)
    mevkktswteeedrilyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv