PDB entry 1idy

View 1idy on RCSB PDB site
Description: structure of myb transforming protein, nmr, minimized average structure
Deposited on 1996-08-15, released 1996-12-23
The last revision prior to the SCOP 1.69 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1idy__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idy_ (-)
    mevkktswteeedrilyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv