PDB entry 1ids

View 1ids on RCSB PDB site
Description: x-ray structure analysis of the iron-dependent superoxide dismutase from mycobacterium tuberculosis at 2.0 angstroms resolutions reveals novel dimer-dimer interactions
Deposited on 1994-09-29, released 1994-12-20
The last revision prior to the SCOP 1.55 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idsA (A:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idsB (B:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idsC (C:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idsD (D:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats