PDB entry 1ids

View 1ids on RCSB PDB site
Description: x-ray structure analysis of the iron-dependent superoxide dismutase from mycobacterium tuberculosis at 2.0 angstroms resolutions reveals novel dimer-dimer interactions
Class: superoxide dismutase
Keywords: superoxide dismutase
Deposited on 1994-09-29, released 1994-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iron superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1idsa1, d1idsa2
  • Chain 'B':
    Compound: iron superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1idsb1, d1idsb2
  • Chain 'C':
    Compound: iron superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1idsc1, d1idsc2
  • Chain 'D':
    Compound: iron superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1idsd1, d1idsd2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1idsA (A:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1idsA (A:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1idsB (B:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1idsB (B:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1idsC (C:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1idsC (C:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1idsD (D:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1idsD (D:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats