PDB entry 1idr

View 1idr on RCSB PDB site
Description: crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis
Class: oxygen storage/transport
Keywords: truncated hemoglobin fold, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2001-04-05, released 2001-08-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin hbn
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1idra_
  • Chain 'B':
    Compound: hemoglobin hbn
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1idrb_
  • Heterogens: PO4, HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1idrA (A:)
    mgllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqve
    ffaaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgvia
    plavdvtsgesttapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1idrA (A:)
    gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
    faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
    lavdvts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1idrB (B:)
    mgllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqve
    ffaaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgvia
    plavdvtsgesttapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1idrB (B:)
    gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
    faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
    lavdvt