PDB entry 1idr

View 1idr on RCSB PDB site
Description: crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis
Deposited on 2001-04-05, released 2001-08-22
The last revision prior to the SCOP 1.59 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1idra_
  • Chain 'B':
    Domains in SCOP 1.59: d1idrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idrA (A:)
    gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
    faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
    lavdvts
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idrB (B:)
    gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
    faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
    lavdvt