PDB entry 1ido

View 1ido on RCSB PDB site
Description: i-domain from integrin cr3, mg2+ bound
Deposited on 1996-03-12, released 1996-08-01
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ido__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ido_ (-)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrek