PDB entry 1idn

View 1idn on RCSB PDB site
Description: mac-1 i domain metal free
Deposited on 1998-06-10, released 1998-11-04
The last revision prior to the SCOP 1.57 freeze date was dated 1998-11-25, with a file datestamp of 1998-11-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.174
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.57: d1idn1_
  • Chain '2':
    Domains in SCOP 1.57: d1idn2_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idn1 (1:)
    sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
    pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
    edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
    rekifaieg
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idn2 (2:)
    sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
    pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
    edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
    rekifaieg