PDB entry 1idm

View 1idm on RCSB PDB site
Description: 3-isopropylmalate dehydrogenase, loop-deleted chimera
Deposited on 1995-05-19, released 1995-09-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.17
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1idm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idm_ (-)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwgtgsvrpeqgllslrksqdlfanlrpakvfpglerlsplkeei
    argvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhvvs
    vdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifgdi
    lsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammlehaf
    glvelarkvedavakalletpppdlggsagteaftatvlrhla