PDB entry 1idl

View 1idl on RCSB PDB site
Description: the nmr solution structure of alpha-bungarotoxin
Class: toxin
Keywords: alpha-bungarotoxin, alpha-neurotoxin, nmr solution structure
Deposited on 2001-04-04, released 2001-04-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-bungarotoxin
    Species: Bungarus multicinctus [TaxId:8616]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1idla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1idlA (A:)
    ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg