PDB entry 1ide

View 1ide on RCSB PDB site
Description: isocitrate dehydrogenase y160f mutant steady-state intermediate complex (laue determination)
Class: oxidoreductase (nad(a)-choh(d))
Keywords: oxidoreductase (nad(a)-choh(d))
Deposited on 1995-01-18, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ICD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08200 (Start-415)
      • engineered (159)
    Domains in SCOPe 2.07: d1idea_
  • Heterogens: MG, ICT, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ideA (A:)
    meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
    rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq
    eldlyiclrpvryyqgtpspvkhpeltdmvifrensedifagiewkadsadaekvikflr
    eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
    fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
    cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
    emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ideA (A:)
    skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
    iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
    dlyiclrpvryyqgtpspvkhpeltdmvifrensedifagiewkadsadaekvikflree
    mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
    dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
    nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
    mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm