PDB entry 1ida

View 1ida on RCSB PDB site
Description: crystal structures of hiv-2 protease in complex with inhibitors containing the hydroxyethylamine dipeptide isostere
Deposited on 1994-10-19, released 1995-01-26
The last revision prior to the SCOP 1.63 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1idaa_
  • Chain 'B':
    Domains in SCOP 1.63: d1idab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1idaA (A:)
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1idaB (B:)
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl