PDB entry 1id8

View 1id8 on RCSB PDB site
Description: nmr structure of glutamate mutase (b12-binding subunit) complexed with the vitamin b12 nucleotide
Class: isomerase
Keywords: Coenzyme B12, Ligand Binding, Nucleotide, Protein NMR spectroscopy, Protein folding, ISOMERASE
Deposited on 2001-04-04, released 2001-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylaspartate mutase s chain
    Species: Clostridium tetanomorphum [TaxId:1553]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1id8a_
  • Heterogens: FOP, DBI

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1id8A (A:)
mekktivlgvigsdchavgnkildhsftnagfnvvnigvlssqedfinaaietkadlicv
sslygqgeidckglrekcdeaglkgiklfvggnivvgkqnwpdveqrfkamgfdrvyppg
tspettiadmkevlgve