PDB entry 1id5

View 1id5 on RCSB PDB site
Description: crystal structure of bovine thrombin complex with protease inhibitor ecotin
Class: hydrolase
Keywords: thrombin, ecotin M84R, conformational changes, hydrolase
Deposited on 2001-04-03, released 2001-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1id5.1
  • Chain 'I':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (Start-141)
      • engineered (83)
    Domains in SCOPe 2.08: d1id5i_
  • Chain 'L':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1id5.1
  • Heterogens: CA, TRS, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1id5H (H:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1id5I (I:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id5I (I:)
    qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
    egwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
    vkyrvwkaeekidnavvr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1id5L (L:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id5L (L:)
    geadcglrplfekkqvqdqtekelfesyie