PDB entry 1id4

View 1id4 on RCSB PDB site
Description: crystal structure of the catalytic site mutant (h157q) of the human cytomegalovirus protease
Class: hydrolase
Keywords: coat protein, hydrolase, serine protease, phosphorylation, viral protease
Deposited on 2001-04-03, released 2001-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p40: assemblin protease
    Species: Human herpesvirus 5 [TaxId:10360]
    Gene: UL80
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16753
      • engineered (156)
    Domains in SCOPe 2.07: d1id4a_
  • Chain 'B':
    Compound: capsid protein p40: assemblin protease
    Species: Human herpesvirus 5 [TaxId:10360]
    Gene: UL80
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16753 (Start-255)
      • engineered (156)
    Domains in SCOPe 2.07: d1id4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1id4A (A:)
    mtmdeqqsqavapvyvggflarydqspdeaelllprdvvehwlhaqgqgqpslsvalpln
    inhddtavvghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkv
    veflsgsyaglslssrrcddveqatslsgsettpfkqvalcsvgrrrgtlavygrdpewv
    tqrfpdltaadrdglraqwqrcgstavdasgdpfrsdsygllgnsvdalyirerlpklry
    dkqlvgvteresyvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id4A (A:)
    qavapvyvggflarydqspdeaelllprdvvehwlalplninhddtavvghvaamqsvrd
    glfclgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsgsyaglslssrfkqv
    alcsvgrrrgtlavygrdpewvtqrfpdltaadrdglraqwqgdpfrsdsygllgnsvda
    lyirerlpklrydkqlvgvteresyvka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1id4B (B:)
    mtmdeqqsqavapvyvggflarydqspdeaelllprdvvehwlhaqgqgqpslsvalpln
    inhddtavvghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkv
    veflsgsyaglslssrrcddveqatslsgsettpfkqvalcsvgrrrgtlavygrdpewv
    tqrfpdltaadrdglraqwqrcgstavdasgdpfrsdsygllgnsvdalyirerlpklry
    dkqlvgvteresyvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id4B (B:)
    deqqsqavapvyvggflarydqspdeaelllprdvvehwlhalplninhddtavvghvaa
    mqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsgsyaglsls
    sfkqvalcsvgrrrgtlavygrdpewvtqrfpdltaadrdglraqwqrstavdgdpfrsd
    sygllgnsvdalyirerlpklrydkqlvgvteresyvka