PDB entry 1id2

View 1id2 on RCSB PDB site
Description: crystal structure of amicyanin from paracoccus versutus (thiobacillus versutus)
Class: electron transport
Keywords: Beta Barrel, type-1 blue copper protein, electron transfer protein, ELECTRON TRANSPORT
Deposited on 2001-04-03, released 2001-04-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.174
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Gene: MAUC OR AMI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1id2a_
  • Chain 'B':
    Compound: amicyanin
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Gene: MAUC OR AMI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1id2b_
  • Chain 'C':
    Compound: amicyanin
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Gene: MAUC OR AMI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1id2c_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1id2A (A:)
    qdkitvtsekpvaaadvpadavvvgiekmkyltpevtikagetvywvngevmphnvafkk
    givgedafrgemmtkdqayaitfneagsydyfctphpfmrgkvive
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1id2B (B:)
    qdkitvtsekpvaaadvpadavvvgiekmkyltpevtikagetvywvngevmphnvafkk
    givgedafrgemmtkdqayaitfneagsydyfctphpfmrgkvive
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1id2C (C:)
    qdkitvtsekpvaaadvpadavvvgiekmkyltpevtikagetvywvngevmphnvafkk
    givgedafrgemmtkdqayaitfneagsydyfctphpfmrgkvive