PDB entry 1id1

View 1id1 on RCSB PDB site
Description: crystal structure of the rck domain from e.coli potassium channel
Class: membrane protein
Keywords: RCK domain, E.coli Potassium Channel, BK Channel, Rossmann fold, MEMBRANE PROTEIN
Deposited on 2001-04-02, released 2001-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative potassium channel protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1id1a_
  • Chain 'B':
    Compound: putative potassium channel protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1id1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1id1A (A:)
    hrkdhfivcghsilaintilqlnqrgqnvtvisnlpeddikqleqrlgdnadvipgdsnd
    ssvlkkagidrcrailalsdndadnafvvlsakdmssdvktvlavsdsknlnkikmvhpd
    iilspqlfgseilarvlngeeinndmlvsmlln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1id1B (B:)
    hrkdhfivcghsilaintilqlnqrgqnvtvisnlpeddikqleqrlgdnadvipgdsnd
    ssvlkkagidrcrailalsdndadnafvvlsakdmssdvktvlavsdsknlnkikmvhpd
    iilspqlfgseilarvlngeeinndmlvsmlln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id1B (B:)
    rkdhfivcghsilaintilqlnqrgqnvtvisnlpeddikqleqrlgdnadvipgdsnds
    svlkkagidrcrailalsdndadnafvvlsakdmssdvktvlavsdsknlnkikmvhpdi
    ilspqlfgseilarvlngeeinndmlvsmlln