PDB entry 1id0

View 1id0 on RCSB PDB site
Description: crystal structure of the nucleotide bond conformation of phoq kinase domain
Deposited on 2001-04-02, released 2001-10-17
The last revision prior to the SCOP 1.61 freeze date was dated 2001-12-28, with a file datestamp of 2001-12-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1id0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1id0A (A:)
relhpvaplldnltsalnkvyqrkgvnisldispeisfvgeqndfvevmgnvldnackyc
lefveisarqtdehlyivveddgpgiplskrevifdrgqrvdtlrpgqgvglavareite
qyegkivagesmlggarmevifgrqh